| Distributors | Register Now  |  
Shopping cart( 0 Items )Order Status  
 
Home
emailprintBook mark

Antimicrobial Peptides

 
Sort by:
Refine by :
 Displaying 1 to 20 (of 1768 products)
 1  2  3  4  5 ...  [Next >>]  
Prod Image Item Name Price / Quantity
A. dehalogenans defensin-like peptide (AdDLP, bacteria, ZZP) A. dehalogenans defensin-like peptide (AdDLP, bacteria, ZZP)
Source: Anaeromyxobacter dehalogenans Class: AdDLP (A. dehalogenans defensin-like peptide, bacteria, ZZP) Sequence:...
... more info
Call for Price
A. dichotoma defensin (insects; SeqAR) A. dichotoma defensin (insects; SeqAR)
Source: beetle, Allomyrina dichotoma Sequence: VTCDLLSFEAKGFAANHSLCAAHCLAIGRRGGSCERGVCICRR Length: 43 Structure: Beta Additional info: It showed activity...
... more info
Call for Price
A. platyrhynchos avian beta-defensin-2 ( Apl_AvBD-2, ducks) A. platyrhynchos avian beta-defensin-2 ( Apl_AvBD-2, ducks)
Source: domestic duck, Anas platyrhynchos Class: Apl_AvBD-2 (A. platyrhynchos avian beta-defensin-2, ducks, birds, animals) Sequence:...
... more info
Call for Price
A3-APO (Pro-rich, synthetic) A3-APO (Pro-rich, synthetic)
Source: engineered Class: Pro-rich, synthetic; other in vivo tested compds: SMAMPs and oligomers of acylated lysines, OAKs Sequence: RPDKPRPYLPRPRPPRPVR ...
... more info
Call for Price
Abaecin (Pro-rich; insects) Abaecin (Pro-rich; insects)
Source: honeybee, Apis mellifera L. Class: (Pro-rich; insects, invertebrates, animals) Sequence: YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY Length: 34 Structure:...
... more info
Call for Price
ABF-2 (antibac/terial factor-2, worms) ABF-2 (antibac/terial factor-2, worms)
Source: the pharyngeal tissues, Caenorhabditis elegans Class: ABF-2 (antibac/terial factor-2, worms, invertebrates, animals) Sequence:...
... more info
Call for Price
ABP-118 (chain a: Abp118alpha, For chain b: Abp118beta) ABP-118 (chain a: Abp118alpha, For chain b: Abp118beta)
Source: Lactobacillus salivarius subsp. salivarius UCC118 Class: ABP-118 (chain a: Abp118alpha, class 2b bacteriocins; Gram-positive bacteria. For chain b:...
... more info
Call for Price
Ac-AMP1 (A. caudatus antimicrobial peptide 1, chitin-binding, plants; BBS) Ac-AMP1 (A. caudatus antimicrobial peptide 1, chitin-binding, plants; BBS)
Source: Seeds, Amaranthus caudatus Class: (A. caudatus antimicrobial peptide 1, chitin-binding, plants; BBS) Sequence: VGECVRGRCPSGMCCSQFGYCGKGPKYCG Length:...
... more info
Call for Price
Ac-AMP2 (A. caudatus antimicrobial peptide 2, chitin-binding, plants; BBS) Ac-AMP2 (A. caudatus antimicrobial peptide 2, chitin-binding, plants; BBS)
Source: seeds, Amaranthus caudatus Class: (A. caudatus antimicrobial peptide 2, chitin-binding, plants; BBS) Sequence: VGECVRGRCPSGMCCSQFGYCGKGPKYCGR ...
... more info
Call for Price
Acaloleptin A1 (insects) Acaloleptin A1 (insects)
Source: Udo longicorn beetle Acalolepta luxuriosa Class: Acaloleptin A1 (insects, invertebrates, animals) Sequence:...
... more info
Call for Price
AcAMP (A. clavatus antimicrobial peptide, fungii) AcAMP (A. clavatus antimicrobial peptide, fungii)
Source: Aspergillus clavatus ES1 Class: AcAMP (A. clavatus antimicrobial peptide, fungii) Sequence: ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYC ...
... more info
Call for Price
aCATH (Gly-rich; Ser-rich; ayu cathelicidin; fish) aCATH (Gly-rich; Ser-rich; ayu cathelicidin; fish)
Source: ayu, Plecoglossus altivelis Class: (Gly-rich; Ser-rich; ayu cathelicidin; fish, animals) Sequence:...
... more info
Call for Price
Acidocin A (bacteriocins; Gram-positive bacteria) Acidocin A (bacteriocins; Gram-positive bacteria)
Source: Lactobacillus acidophilus TK9201 Class: Acidocin A (bacteriocins; Gram-positive bacteria) Sequence:...
... more info
Call for Price
Acidocin B (XXC, class 2c circular bacteriocin; Gram-positive bacteria) Acidocin B (XXC, class 2c circular bacteriocin; Gram-positive bacteria)
Source: Lactobacillus acidophilus M46 Class: Acidocin B (XXC, class 2c circular bacteriocin; Gram-positive bacteria) Sequence:...
... more info
Call for Price
Acidocin J1132 (class 2b bacteriocins; Gram-positive bacteria) Acidocin J1132 (class 2b bacteriocins; Gram-positive bacteria)
Source: Lactobacillus acidophilus JCM 1132 Class: Acidocin J1132 (class 2b bacteriocins; Gram-positive bacteria) Sequence: NPKVAHCASQIGRSTAWGAVSGA Length:...
... more info
Call for Price
Actagardine (class 1 bacteriocin, Gram-positive bacteria) Actagardine (class 1 bacteriocin, Gram-positive bacteria)
Source: Actinoplanes garbadinensis ATCC31048 and 31049 Class: (old names: gardimycin, metabolite B; lantibiotic, type 2, type B, class 1 bacteriocin,...
... more info
Call for Price
Adepantin-1 (synthetic) Adepantin-1 (synthetic)
Source: Synthesis Class: Adepantin-1 (Automatically Designed Peptide Antibiotic 1; computational design; synthetic) Sequence: GIGKHVGKALKGLKGLLKGLGES ...
... more info
Call for Price
ADP-1 (Amblyomma defensin peptide 1, hard tick, DXWZ) ADP-1 (Amblyomma defensin peptide 1, hard tick, DXWZ)
Source: Amblyomma hebraeum Class: ADP-1 (Amblyomma defensin peptide 1, hard tick, arthropod, arachnids, invertebrates, animals, DXWZ) Sequence:...
... more info
Call for Price
ADP-2 (Amblyomma defensin peptide 2, hard tick) ADP-2 (Amblyomma defensin peptide 2, hard tick)
Source: Amblyomma hebraeum Class: (Amblyomma defensin peptide 2, hard tick, arthropod, arachnids, invertebrates, animals) Sequence:...
... more info
Call for Price
Adrenomedullin (XXA; neuropeptide; human) Adrenomedullin (XXA; neuropeptide; human)
Source: Homo sapiens Class: Adrenomedullin (XXA; neuropeptide; 1S=S; human) Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY Length: 52 ...
... more info
Call for Price
 Displaying 1 to 20 (of 1768 products)
 1  2  3  4  5 ...  [Next >>]  
 
dPEG
  bulk-order Download product catalog bioworld providing high level security by using Godaddy secured certificate (SSL) and Payjuction payment gateway  

Have you seen ...

Carbenicillin disodium salt

Recently viewed items

 
 
Featured Items: