| Distributors | Register Now  |  
Shopping cart( 0 Items )Order Status  
 
Home
emailprintBook mark

Antimicrobial Peptides

 
Sort by:
Refine by :
 Displaying 1 to 20 (of 1768 products)
 1  2  3  4  5 ...  [Next >>]  
Prod Image Item Name Price / Quantity
A. dehalogenans defensin-like peptide (AdDLP, bacteria, ZZP) A. dehalogenans defensin-like peptide (AdDLP, bacteria, ZZP)
Source: Anaeromyxobacter dehalogenans Class: AdDLP (A. dehalogenans defensin-like peptide, bacteria, ZZP) Sequence:...
... more info
Call for Price
A. dichotoma defensin (insects; SeqAR) A. dichotoma defensin (insects; SeqAR)
Source: beetle, Allomyrina dichotoma Sequence: VTCDLLSFEAKGFAANHSLCAAHCLAIGRRGGSCERGVCICRR Length: 43 Structure: Beta Additional info: It showed activity...
... more info
Call for Price
A. platyrhynchos avian beta-defensin-2 ( Apl_AvBD-2, ducks) A. platyrhynchos avian beta-defensin-2 ( Apl_AvBD-2, ducks)
Source: domestic duck, Anas platyrhynchos Class: Apl_AvBD-2 (A. platyrhynchos avian beta-defensin-2, ducks, birds, animals) Sequence:...
... more info
Call for Price
A3-APO (Pro-rich, synthetic) A3-APO (Pro-rich, synthetic)
Source: engineered Class: Pro-rich, synthetic; other in vivo tested compds: SMAMPs and oligomers of acylated lysines, OAKs Sequence: RPDKPRPYLPRPRPPRPVR ...
... more info
Call for Price
Abaecin (Pro-rich; insects) Abaecin (Pro-rich; insects)
Source: honeybee, Apis mellifera L. Class: (Pro-rich; insects, invertebrates, animals) Sequence: YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY Length: 34 Structure:...
... more info
Call for Price
ABF-2 (antibac/terial factor-2, worms) ABF-2 (antibac/terial factor-2, worms)
Source: the pharyngeal tissues, Caenorhabditis elegans Class: ABF-2 (antibac/terial factor-2, worms, invertebrates, animals) Sequence:...
... more info
Call for Price
ABP-118 (chain a: Abp118alpha, For chain b: Abp118beta) ABP-118 (chain a: Abp118alpha, For chain b: Abp118beta)
Source: Lactobacillus salivarius subsp. salivarius UCC118 Class: ABP-118 (chain a: Abp118alpha, class 2b bacteriocins; Gram-positive bacteria. For chain b:...
... more info
Call for Price
Ac-AMP1 (A. caudatus antimicrobial peptide 1, chitin-binding, plants; BBS) Ac-AMP1 (A. caudatus antimicrobial peptide 1, chitin-binding, plants; BBS)
Source: Seeds, Amaranthus caudatus Class: (A. caudatus antimicrobial peptide 1, chitin-binding, plants; BBS) Sequence: VGECVRGRCPSGMCCSQFGYCGKGPKYCG Length:...
... more info
Call for Price
Ac-AMP2 (A. caudatus antimicrobial peptide 2, chitin-binding, plants; BBS) Ac-AMP2 (A. caudatus antimicrobial peptide 2, chitin-binding, plants; BBS)
Source: seeds, Amaranthus caudatus Class: (A. caudatus antimicrobial peptide 2, chitin-binding, plants; BBS) Sequence: VGECVRGRCPSGMCCSQFGYCGKGPKYCGR ...
... more info
Call for Price
Acaloleptin A1 (insects) Acaloleptin A1 (insects)
Source: Udo longicorn beetle Acalolepta luxuriosa Class: Acaloleptin A1 (insects, invertebrates, animals) Sequence:...
... more info
Call for Price
AcAMP (A. clavatus antimicrobial peptide, fungii) AcAMP (A. clavatus antimicrobial peptide, fungii)
Source: Aspergillus clavatus ES1 Class: AcAMP (A. clavatus antimicrobial peptide, fungii) Sequence: ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYC ...
... more info
Call for Price
aCATH (Gly-rich; Ser-rich; ayu cathelicidin; fish) aCATH (Gly-rich; Ser-rich; ayu cathelicidin; fish)
Source: ayu, Plecoglossus altivelis Class: (Gly-rich; Ser-rich; ayu cathelicidin; fish, animals) Sequence:...
... more info
Call for Price
Acidocin A (bacteriocins; Gram-positive bacteria) Acidocin A (bacteriocins; Gram-positive bacteria)
Source: Lactobacillus acidophilus TK9201 Class: Acidocin A (bacteriocins; Gram-positive bacteria) Sequence:...
... more info
Call for Price
Acidocin B (XXC, class 2c circular bacteriocin; Gram-positive bacteria) Acidocin B (XXC, class 2c circular bacteriocin; Gram-positive bacteria)
Source: Lactobacillus acidophilus M46 Class: Acidocin B (XXC, class 2c circular bacteriocin; Gram-positive bacteria) Sequence:...
... more info
Call for Price
Acidocin J1132 (class 2b bacteriocins; Gram-positive bacteria) Acidocin J1132 (class 2b bacteriocins; Gram-positive bacteria)
Source: Lactobacillus acidophilus JCM 1132 Class: Acidocin J1132 (class 2b bacteriocins; Gram-positive bacteria) Sequence: NPKVAHCASQIGRSTAWGAVSGA Length:...
... more info
Call for Price
Actagardine (class 1 bacteriocin, Gram-positive bacteria) Actagardine (class 1 bacteriocin, Gram-positive bacteria)
Source: Actinoplanes garbadinensis ATCC31048 and 31049 Class: (old names: gardimycin, metabolite B; lantibiotic, type 2, type B, class 1 bacteriocin,...
... more info
Call for Price
Adepantin-1 (synthetic) Adepantin-1 (synthetic)
Source: Synthesis Class: Adepantin-1 (Automatically Designed Peptide Antibiotic 1; computational design; synthetic) Sequence: GIGKHVGKALKGLKGLLKGLGES ...
... more info
Call for Price
ADP-1 (Amblyomma defensin peptide 1, hard tick, DXWZ) ADP-1 (Amblyomma defensin peptide 1, hard tick, DXWZ)
Source: Amblyomma hebraeum Class: ADP-1 (Amblyomma defensin peptide 1, hard tick, arthropod, arachnids, invertebrates, animals, DXWZ) Sequence:...
... more info
Call for Price
ADP-2 (Amblyomma defensin peptide 2, hard tick) ADP-2 (Amblyomma defensin peptide 2, hard tick)
Source: Amblyomma hebraeum Class: (Amblyomma defensin peptide 2, hard tick, arthropod, arachnids, invertebrates, animals) Sequence:...
... more info
Call for Price
Adrenomedullin (XXA; neuropeptide; human) Adrenomedullin (XXA; neuropeptide; human)
Source: Homo sapiens Class: Adrenomedullin (XXA; neuropeptide; 1S=S; human) Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY Length: 52 ...
... more info
Call for Price
 Displaying 1 to 20 (of 1768 products)
 1  2  3  4  5 ...  [Next >>]  
 
IPTG
  WOSB_Certification_Award_Recognition bulk-order Download product catalog bioworld providing high level security by using Godaddy secured certificate (SSL) and Payjuction payment gateway  

Have you seen ...

AMP Separopore®

Recently viewed items

 
 
Featured Items: