| Distributors | Register Now  |  
Shopping cart( 0 Items )Order Status  
 
Home
emailprintBook mark

Antimicrobial Peptides

 
Sort by:
Refine by :
 Displaying 1 to 20 (of 59 products)
 1  2  3  [Next >>]  
Prod Image Item Name Price / Quantity
A. platyrhynchos avian beta-defensin-2 ( Apl_AvBD-2, ducks) A. platyrhynchos avian beta-defensin-2 ( Apl_AvBD-2, ducks)
Source: domestic duck, Anas platyrhynchos Class: Apl_AvBD-2 (A. platyrhynchos avian beta-defensin-2, ducks, birds, animals) Sequence:...
... more info
Call for Price
Ah-AMP1 (antimicrobial peptide from A. hippocastanum, plant defensin) Ah-AMP1 (antimicrobial peptide from A. hippocastanum, plant defensin)
Source: Horse chestnuts, Aesculus hippocastanum Class: Ah-AMP1 (AhAMP1, antimicrobial peptide from A. hippocastanum, plant defensin; plants) Sequence:...
... more info
Call for Price
Amoebapore A (Amoeba peptide; saposin-like protein, SAPLIP; parasite) Amoebapore A (Amoeba peptide; saposin-like protein, SAPLIP; parasite)
Source: protozoan parasite, Entamoeba histolytica Class: Amoebapore A (Amoeba peptide; saposin-like protein, SAPLIP; parasite, amoebozoa, protozoan) ...
... more info
Call for Price
Anionic peptide SAAP (Asp-rich, sheep) Anionic peptide SAAP (Asp-rich, sheep)
Source: Pasterurella haemolytica Class: Anionic peptide SAAP (Asp-rich, sheep, animals) Sequence: DDDDDD Length: 6 Structure: Unknown Additional info:...
... more info
Call for Price
Brazzein (defensins; plants) Brazzein (defensins; plants)
Source: pulp, fruits, Pentadiplandra brazzeana Baillon Class: Brazzein (defensins; plants) Sequence: QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY ...
... more info
Call for Price
Caerin 1.3 (XXA, frog) Caerin 1.3 (XXA, frog)
Source: Australian frog Litoria caerula Class: Caerin 1.3 (XXA, frog, amphibians, animals) Sequence: GLLSVLGSVAQHVLPHVVPVIAEHL Length: 25 Structure: Helix ...
... more info
Call for Price
Cathelicidin-BF (snake cathelicidin) Cathelicidin-BF (snake cathelicidin)
Source: snake venom Bungarus fasciatus Class: Cathelicidin-BF (snake cathelicidin, reptiles, animals) Sequence: KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF Length: 30 ...
... more info
Call for Price
Cecropin A (insects) Cecropin A (insects)
Source: Noctuid moth Class: Cecropin A (insects, invertebrates, animals) Sequence: RWKVFKKIEKVGRNIRDGVIKAAPAIEVLGQAKAL Length: 35 Structure: Unknown ...
... more info
Call for Price
Ci-MAM-A24 (Ciona-molecule against microbes A 24-residues; sea squirt; XXA) Ci-MAM-A24 (Ciona-molecule against microbes A 24-residues; sea squirt; XXA)
Source: Ciona intestinalis Class: Ci-MAM-A24 (Ciona-molecule against microbes A 24-residues; sea squirt, marine invertebrates, animals; XXA) Sequence:...
... more info
Call for Price
Citropin 1.1 (XXA, frog) Citropin 1.1 (XXA, frog)
Source: Australian blue mountains tree frog, Litoria citropa Class: Citropin 1.1 (XXA, frog, amphibians, animals) Sequence: GLFDVIKKVASVIGGL Length: 16 ...
... more info
Call for Price
Cn-AMP1 (Cocos nucifera L. antimicrobial peptide 1, plants) Cn-AMP1 (Cocos nucifera L. antimicrobial peptide 1, plants)
Source: green coconut water, Cocos nucifera Class: Cn-AMP1 (Cocos nucifera L. antimicrobial peptide 1, plants) Sequence: SVAGRAQGM Length: 9 Structure:...
... more info
Call for Price
Ct-AMP1 (CtAMP1, C. ternatea-antimicrobial peptide 1; defensins; plants) Ct-AMP1 (CtAMP1, C. ternatea-antimicrobial peptide 1; defensins; plants)
Source: Clitoria ternatea Class: Ct-AMP1 (CtAMP1, C. ternatea-antimicrobial peptide 1; defensins; plants) Sequence:...
... more info
Call for Price
Cycloviolacin O13 (cyclotides; plants; XXC, ZZHp, ZZP) Cycloviolacin O13 (cyclotides; plants; XXC, ZZHp, ZZP)
Source: Viola odorata Class: Cycloviolacin O13 (cyclotides; plants; XXC, ZZHp, ZZP) Sequence: GIPCGESCVWIPCISAAIGCSCKSKVCYRN Length: 30 Structure: Bridge ...
... more info
Call for Price
Cycloviolacin O2 (cyclotides; plants; XXC; ZZP) Cycloviolacin O2 (cyclotides; plants; XXC; ZZP)
Source: Viola odorata Class: Cycloviolacin O2 (cyclotides; plants; XXC; ZZP) Sequence: CGESCVWIPCISSAIGCSCKSKVCYRNGIP Length: 30 Structure: Bridge ...
... more info
Call for Price
Cypemycin (linaridins, bacteria) Cypemycin (linaridins, bacteria)
Source: Streptomyces sp. OH-4156 Class: Cypemycin (linaridins, bacteria) Sequence: ATPATPTVAQFVIQGSTICLVC Length: 22 Structure: Unknown Additional info:...
... more info
Call for Price
Dm-AMP1 (DmAMP1, Dahlia defensin, C8 type; plants) Dm-AMP1 (DmAMP1, Dahlia defensin, C8 type; plants)
Source: seeds, Dahlia merckii Class: Dm-AMP1 (DmAMP1, Dahlia defensin, C8 type; 4s=s; BBMm_M(IP)2C; plants) Sequence:...
... more info
Call for Price
Duramycin C (Lantibiotic, type B, class 1 bacteriocin, Gram-positive bacteria; XXT) Duramycin C (Lantibiotic, type B, class 1 bacteriocin, Gram-positive bacteria; XXT)
Source: Streptomyces griseoluteus R2107 Class: Duramycin C (Lantibiotic, type B, class 1 bacteriocin, Gram-positive bacteria; XXT) Sequence:...
... more info
Call for Price
Epilancin K7 (lantibiotic, class 1 bacteriocin; Gram-positive bacteria; XXT3, XXW5) Epilancin K7 (lantibiotic, class 1 bacteriocin; Gram-positive bacteria; XXT3, XXW5)
Source: Staphylococcus epidermidis K7 Class: pilancin K7 (lantibiotic, class 1 bacteriocin; Gram-positive bacteria; XXT3, XXW5) Sequence:...
... more info
Call for Price
Ericin A (Lantibiotic, type 1, class 1 bacteriocin, Gram-positive bacteria; XXT5; XXW1) Ericin A (Lantibiotic, type 1, class 1 bacteriocin, Gram-positive bacteria; XXT5; XXW1)
Source: Bacillus subtilis A1/3 Class: Ericin A (Lantibiotic, type 1, class 1 bacteriocin, Gram-positive bacteria; XXT5; XXW1) Sequence:...
... more info
Call for Price
Ericin S (lantibiotic, type 1, class 1 bacteriocin, Gram-positive bacteria; XXT; XXW) Ericin S (lantibiotic, type 1, class 1 bacteriocin, Gram-positive bacteria; XXT; XXW)
Source: Bacillus subtilis A1/3 Class: Ericin S (lantibiotic, type 1, class 1 bacteriocin, Gram-positive bacteria; XXT; XXW) Sequence:...
... more info
Call for Price
 Displaying 1 to 20 (of 59 products)
 1  2  3  [Next >>]  
 
DMSO-Bio-Max™
  bulk-order Download product catalog bioworld providing high level security by using Godaddy secured certificate (SSL) and Payjuction payment gateway  

Recently viewed items

 
 
Featured Items: