E.Coli Thioredoxin (Recombinant)

Recombinant Thioredoxin (Trx)

Source: E. coli

Description: Thioredoxins are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms. Thioredoxin contains a single disulfide active site and serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. It has been suggested that thioredoxin may catalyze the formation of correct disulfides during protein folding because of its ability to act as an efficient oxidoreductant. This could be especially useful in refolding proteins expressed in E. coli. To this end, thioredoxin has been shown to act as a protein disulfide isomerase. Its Molecular Weight is 11.9kDa. and the pI is 4.67.

Physical Appearance: Sterile White lyophilized powder.

Formulation: Each mg of protein contains 20mM phosphate buffer pH 7.4.

Solubility: It is recommended to reconstitute the lyophilized Recombinant TRX in sterile 18MΩ-cm H₂O.

Stability: Recombinant TRX although stable at 4°C for 3 weeks, should be stored desiccated below -18°C. Please avoid freeze-thaw cycles.

Amino acid sequence: HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA

Purity: Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Biological Activity: TRX activity is assayed by measuring the change in absorbance at 650 nm at 25°C using 0.13 μM bovine insulin containing 0.33mM DTT (pH 6.5). The specific activity was found to be 3IU/mg.

Usage: BioWORLD's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.