Human Melanoma Inhibitory Activity Protein (Recombinant)

Recombinant Human Melanoma Inhibitory Activity Protein (MIA)

Source: E.Coli

Background: MIA acts as a potent tumor cell growth inhibitor for malignant melanoma cells and some other neuroectodermal tumors, including gliomas, in an autocrine fashion. In a study of human melanoma cell lines with different metastatic capacity MIA mRNA expression appeared to be inversely correlated with pigmentation. MIA has been shown to represent a very sensitive and specific serum marker for systemic malignant melanoma that might be useful for staging of primary melanomas, detection of progression from localized to metastatic disease during follow-up, and monitoring therapy of advanced melanomas.

Description: Recombinant Human MIA produced in E.Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton. The Melanoma Inhibitory protein (MIA) was identified as an inhibitor of in vitro growth of malignant melanoma cells. The protein contains a SH3 domain. Human Melanoma Inhibitory protein is purified by proprietary chromatographic techniques

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Recombinant MIA was lyophilized from a concentrated (1mg/ml) solution containing 20mM Potassium-phosphate pH=7 and 150mM potassium chloride.

Solubility: It is recommended to reconstitute the lyophilized Human MIA in sterile 18MO-cm H2O not less than 100 g/ml, which can then be further diluted to other aqueous solutions.

Stability: Lyophilized Recombinant MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18 C. Upon reconstitution Recombinant MIA should be stored at 4 C between 2-7 days and for future use below -18 C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.

Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Anion-exchange FPLC. (c) Analysis by reducing and non-reducing SDS-PAGE Silver Stained gel

Amino-Acid Sequence: Agrees with the sequence of native human MIA with an addition N-terminal Methionine residue. MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKTDKWDFYCQ

Dimers and aggregates: Less than 1% as determined by silver-stained SDS-PAGE gel analysis.

Biological Activity: M-CSF is fully biologically active when compared to standard. The ED50, calculated by the dose-dependant stimulation of the proliferation of murine M-NFS-60 indicator cells was found < 5ng/ml, corresponding to a Specific Activity of 2 x 105 IU/mg.

Endotoxin: Less than 0.1 ng/ g (IEU/ g) of M-CSF.

Protein content: Protein quantitation was carried out by two independent methods: 1. UV spectroscopy at 280 nm using the absorbption coefficient of 19300 M-1cm-1 . 2. Analysis by RP-HPLC, using a calibrated solution of MIA as a Reference Standard.

Usage: BioWORLD\\\'s products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.