Human Neuregulin-1/Heregulin-Beta 2 (Recombinant)

Recombinant Human Heregulin-beta2

Source: E. Coli

Background: Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that recombinant neuregulin could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that recombinant neuregulin (NRG1) can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection.

Description: Recombinant Human Heregulin-b1/Neuroregulin-1 (Neu differentiation factor) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids ,comprised of the EGF-like domain, and having a total molecular mass of 7055Dalton. Recombinant Human NRG1 is purified by proprietary chromatographic techniques.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized from a 0.2 m filtered solution (0.25mg/ml) in 20mM PB, pH 7.0, containing 0.5%HSA and 2% mannitol.

Solubility: It is recommended to reconstitute the lyophilized Recombinant NRG1 in sterile 18MO-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Stability: Lyophilized Recombinant Human NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution rHuNRG1 should be stored at 4°C for 2-7 days and below -18°C for longer. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.

Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis bySDS-PAGE.

Amino acid sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Biological Activity: Recombinant Human NRG1 is fully biologically active when compared to standard. The activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2×10⁴ Units/mg.

Protein content: Protein quantitation was carried out by two independent methods: 1. UV spectroscopy at 280 nm. 2. Analysis by RP-HPLC, using a standard solution of NRG1 as a Reference Standard.

Usage: BioWORLD's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.