Human Pro-Nerve Growth Factor (Recombinant)

Recombinant Human Pro-Nerve Growth Factor (ProNGF)

Source: E. Coli

Description ProNGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein proNGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Recombinant Human Pro-NGF produced in E.Coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton. Recombinant Pro-NGF is purified by proprietary chromatographic techniques.

Physical Appearance: Sterile Filtered clear solution.

Formulation: The sterile protein solution 1.2mg/ml contains 50mM sodium phosphate buffer pH 7.2. 150mM sodium chloride.

Stability: Recombinant human ProNGF although stable at 15°C for 1 week, should be stored at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.

Purity: Greater than 98.0% as determined by: (a) SDS-PAGE.

Amino-Acid Sequence:
MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVL FSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVM VLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTA CVCVLSRKAVR.

Dimers and aggregates: Less than 1% as determined by silver-stained SDS-PAGE gel analysis.

Biological Activity: The activity of the protein can by measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85). EC₅₀ 130 ±30 pM (TF1 cell assay)

Usage: BioWORLD's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.