Myelin Oligodendrocyte Glycoprotein Human, Recombinant

Synonyms

Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.

Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.

Description

Myelin Oligodendrocyte Glycoprotein produced in E. coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.

Source

Escherichia coli

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.

Solubility

It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Stability

Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Recommended Applications

5-20µg per ml for In-Vitro Experiments and 50-100µg per animal for In-Vivo study. The protein can be used for T-cell proliferation, cytokine induction, antigen presentation, western blotting, ELISA and EAE induction in mice.

Amino Acid Sequence

MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN GKDQDGDQAPEY RGRTELLKDA IGEGKVTLRIRNV RFSDEGGFTCFFRDHSYQE EAAMELKVEDPFYWVSPGHHHHHH

Usage

Bio-world products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Related Products

MOG, MOG Antibody